How to Use Server Profiles
Valid for versions 106 through the latest version
Version:
106
Last modified: 2024 March 26
Overview
Server profiles let you set up servers to perform specific tasks or functions. They also manage roles that enable or disable task-specific services. For example, the Mail server profile disables most non-mail services. This server hosts accounts that only need mail features and not other services.
- You can configure your server’s profile with WHM’s Server Profile interface (WHM » Home » Server Configuration » Server Profile).
- Server profiles hide some cPanel & WHM interfaces and block some associated API functions.
- This feature doesn’t block you from manually installing software.
- Attempts to customize this feature are not supported and can cause unwanted results.
The system uses the dynamicui.conf files’s roles and services values to display and hide features in the interface. Don’t modify this file or these values. We don’t support this behavior.
Server profiles and licenses
Your cPanel & WHM license may determine your server’s profile.
- You can buy a cPanel Solo® License for a server that uses any profile, but that server’s cPanel & WHM access will only allow one user.
- For more information, read the Profiles section below.
Roles
- If a role disables a service, the system disables the role’s related modules and functions.
- If a server profile enables a service, the system will also enable service monitoring. To disable this, use WHM’s Service Manager interface (WHM » Home » Service Configuration » Service Manager).
Roles are collections of one or more services. Profiles use roles to provide specific server functionality. A server profile may consist of one or more of the following roles:
| Role | Description | Module name | Services |
|---|---|---|---|
| Calendars and Contacts | Allows users to access CalDAV and CardDAV services and features. | CalendarContact |
cpdavd |
| DNS | Allows users to create and edit Domain Name System (DNS) zone files.
Important:
|
DNS |
bind, named, pdns, powerdns |
| File Storage | Allows users to access cPanel’s File Manager and Git™ Version Control features.
Note:
When a profile disables this role, you can’t enable the Shell Access setting when you create a new cPanel account.
|
FileStorage |
There are currently no services for this role. |
| FTP | Allows users to manage their account’s files with an FTP client. | FTP |
ftpd, pureftp, proftpd |
| Local Mail | Allows the control of local mail delivery and related features. | MailLocal |
exim, dovecot |
| MySQL Client | This role checks whether the MySQL/MariaDB client access exists locally or remotely.
Note:
You cannot directly enable or disable this role. The system enables or disables this role depending on the MySQL configuration.
|
MySQLClient |
None. |
| MySQL/MariaDB | Allows users to create and manage MySQL® or MariaDB databases. | MySQL |
mysql |
| PostgreSQL | Allows users to create and manage PostgreSQL databases if cPanel & WHM manages the server’s PostgreSQL.
Note:
You must install PostgreSQL to enable this optional role.
|
Postgres |
postgresql |
| Receive Mail | Allows users to receive mail from external sources. | MailReceive |
cpanel_dovecot_solr, cpdavd, cpgreylistd, dovecot, imap, mailman, pop |
| Relay Mail | Allows the server’s Message Transfer Agent (MTA) to forward mail from one remote host to another. | MailRelay |
exim, exim-altport |
| Send Mail | Allows users to send mail and control the features necessary for sending mail. | MailSend |
exim, exim-altport |
| Spam Filter | Allows users to use Apache SpamAssassin™ to identify, sort, and delete unsolicited mail. | SpamFilter |
spamd |
| Webmail | Allows users to access webmail services and features. | Webmail |
There are currently no services for this role. |
| Web Disk | Allows users to manage their account’s files with a WebDAV client. | WebDisk |
cpdavd |
| Web Server | Allows users to create and manage websites for their domains.
Important:
When a profile disables this role, the system takes specific actions. For more information, read the Disabled Web Server role section below.
|
WebServer |
httpd |
Disabled Web Server role
When a profile disables this role, the system applies two restrictions:
-
You can’t enable the CGI Access setting when you create a new cPanel account.
-
The
cpsrvddaemon takes over service for the standard HTTP ports80and443.- This ensures that cPanel & WHM features that depend on these ports continue to function. For example, the AutoSSL, Mailman, and BoxTrapper features depend on these ports.
- To prevent the
cpsrvddaemon from serving ports80and443, enable the Prevent cpsrvd from serving standard HTTP ports setting in WHM’s Tweak Settings interface (WHM » Home » Server Configuration » Tweak Settings).
Profiles
Server profiles provide performance improvements, not necessarily additional security.
Distributed accounts have the same level of access on the child node as they do on the parent node. This access allows linked nodes to work smoothly with existing systems. We are researching methods to transition to a reduced access security model in a future version.
You can select from one of the following profiles:
Standard
This profile provides all services and has access to all cPanel interfaces. This is the default server profile for a full cPanel & WHM license.
Roles
This profile provides all services and has access to all cPanel interfaces.
Disabled services
This profile doesn’t disable any cPanel & WHM services.
Interfaces
- This profile enables all WHM interfaces.
- This profile allows cPanel users access to all cPanel interfaces.
DNS
This profile allows the system to serve Domain Name System (DNS) zones.
- If you purchase a DNS license, the system defaults to this profile.
- You can’t select a different profile.
- You must upgrade to a full cPanel & WHM license to select a new profile.
- Only cPanel partners can purchase DNS licenses.
- Selecting this profile doesn’t convert your server to a cPanel DNSOnly server.
Roles
This profile has the following role configuration:
| Role | Enabled | Disabled | Optional |
|---|---|---|---|
| Calendars and Contacts | |||
| DNS | |||
| File Storage | |||
| FTP | |||
| Local Mail | |||
| MySQL/MariaDB | |||
| PostgreSQL | |||
| Receive Mail | |||
| Relay Mail | |||
| Send Mail | |||
| Spam Filter | |||
| Webmail | |||
| Web Disk | |||
| Web Server |
Disabled services
This profile disables the following services:
cpanel_dovecot_solrcpdavdcpgreylistdftpdhttpdimapmailmanmysqlpoppostgresqlproftpdpureftpspamd
Interfaces
By default, this profile disables the following WHM interfaces:
| WHM section | Interfaces |
|---|---|
| Account Functions |
|
| Account Information |
|
| cPanel |
|
| DNS Functions |
|
|
|
| Restart Services |
|
| Security Center |
|
| Server Configuration |
|
| Server Status |
|
| Service Configuration |
|
| Software |
|
| SQL Services |
|
| Transfers |
|
By default, this profile and the optional MySQL/MariaDB role allow cPanel users access to the following interfaces:
| cPanel section | Interfaces |
|---|---|
| Advanced |
|
| Databases |
|
| Domains |
|
|
|
| Files |
|
| Metrics |
|
| Preferences |
|
| Security |
|
This profile allows the system to serve mail. Certain cPanel & WHM features, such as AutoSSL and GNU Mailman, require HTTP service. On a Mail server profile, the server disables the web server but enables the cpsrvd service to handle the TCP ports 80 and 443. This ensures that HTTP-dependent cPanel & WHM features continue to function.
Warnings
You must comply with all of the instructions below.
The following instructions apply to synchronization for linked mail child nodes:
- Do not make changes to
userdatafiles on a child node directly. We do not offer support if you make these changes. This behavior could cause the nodes to become out of sync. - You must manually update system settings on a linked node (for example, server or Exim configuration settings).
- System and user configurations do not propagate from the child to the parent node.
- Do not update your node’s hostname after you link two nodes. This operation could corrupt the nodes’ ability to communicate.
- You cannot enable IPv6 on a cPanel account if you want to distribute that account to a mail node.
- If you manually edited your zone templates, you must update the mail CNAME record. For example, update:
to:
mail IN CNAME %domain%mail IN CNAME %maildomain%
The following instructions apply to cPanel account restoration for linked mail child nodes:
- When you restore a cPanel account, the A records for service subdomains may be different than when you created the cPanel account. Compare the restored zone records to your current records to repair them manually.
- You must perform backups for linked cPanel accounts on the controller node.
Roles
This profile has the following role configuration:
| Role | Enabled | Disabled | Optional |
|---|---|---|---|
| Calendars and Contacts | |||
| DNS | |||
| File Storage | |||
| FTP | |||
| Local Mail | |||
| MySQL/MariaDB | |||
| PostgreSQL | |||
| Receive Mail | |||
| Relay Mail | |||
| Send Mail | |||
| Spam Filter | |||
| Webmail | |||
| Web Disk | |||
| Web Server |
Disabled services
This profile disables the following services:
ftpdhttpdmysqlpostgresqlproftpdpureftp
Interfaces
By default, this profile disables the following WHM interfaces:
| WHM section | Interfaces |
|---|---|
| Account Functions |
|
| Account Information |
|
| Clusters |
|
| cPanel |
|
| DNS Functions |
|
|
|
| Resellers |
|
| Restart Services |
|
| Security Center |
|
| Server Configuration |
|
| Server Status |
|
| Service Configuration |
|
| Software |
|
| SQL Services |
|
| SSL/TLS |
|
By default, this profile and its roles let cPanel users access the following interfaces:
| cPanel section | Interfaces |
|---|---|
| Advanced |
|
| Domains |
|
|
|
| Files |
|
| Preferences |
|
| Security |
|
Database
By default, this profile allows the server to only serve databases.
This profile is experimental, and we do not recommend it for production environments.
Roles
This profile has the following role configuration:
| Role | Enabled | Disabled | Optional |
|---|---|---|---|
| Calendars and Contacts | |||
| DNS | |||
| File Storage | |||
| FTP | |||
| Local Mail | |||
| MySQL/MariaDB | |||
| PostgreSQL | |||
| Receive Mail | |||
| Relay Mail | |||
| Send Mail | |||
| Spam Filter | |||
| Webmail | |||
| Web Disk | |||
| Web Server |
Disabled services
By default, this profile disables the following services:
bindcpanel_dovecot_solrcpdavdcpgreylistdftpdhttpdimapmailmannamednsdpdnspoppowerdnsproftpdpureftpspamd
Interfaces
By default, this profile disables the following WHM interfaces:
| WHM section | Interfaces |
|---|---|
| Account Functions |
|
| Account Information |
|
| Clusters |
|
| cPanel |
|
| DNS Functions |
|
|
|
| Restart Services |
|
| Security Center |
|
| Server Configuration |
|
| Server Status |
|
| Service Configuration |
|
| Software |
|
By default, this profile allows cPanel users access to the following interfaces:
| cPanel section | Interfaces |
|---|---|
| Advanced |
|
| Databases |
|
|
|
| Files |
|
| Metrics |
|
| Preferences |
|
| Security |
|
The cphttpd service
The system uses the cphttpd service on DNSOnly, MailNode, and other non-web hosting server profiles as a method to provide hostname SSL certificates. This process listens and responds to requests on ports 80 and 443 so that the AutoSSL service can run for your hostname.